PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Kalax.0153s0020.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Saxifragales; Crassulaceae; Kalanchoe
Family G2-like
Protein Properties Length: 508aa    MW: 55725.4 Da    PI: 4.7095
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Kalax.0153s0020.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like107.57e-34277331155
              G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                          k+r+rWtpeLHe+Fveav+qLGG e+AtPk +l+lmkv+gLt++hvkSHLQkYR+
  Kalax.0153s0020.1.p 277 KQRMRWTPELHEAFVEAVNQLGGGERATPKGVLKLMKVEGLTIYHVKSHLQKYRT 331
                          79****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129413.477274334IPR017930Myb domain
Gene3DG3DSA:1.10.10.605.7E-32275333IPR009057Homeodomain-like
SuperFamilySSF466896.27E-18276331IPR009057Homeodomain-like
TIGRFAMsTIGR015573.8E-25277331IPR006447Myb domain, plants
PfamPF002491.2E-10279330IPR001005SANT/Myb domain
PfamPF143798.8E-26362409IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 508 aa     Download sequence    Send to blast
MDAPHMSIYG SGANQHLGVS AAQSSSLPVL PTRLQETFPK YSDPQQFYMG RDVMTDTMGR  60
HGNSLPSNSA VVGHIISSPS AYSANLHFSS DSVNEKQSNS SLLISQSSFD MKAMLSTHSN  120
GSEVLQPSTL TQYHGESDNS SWCAESLQSF LDYRAPVDEN HLENTCNGAV PVEAAKQNDW  180
QEWADHFITD DDALNTNWSD LLVDATVESL EPEIVYQVPR PPSDVVIQQP PSDVVIAESQ  240
PQQQPQVQSQ AQLHLLPASS CETAVLPASS SNNSAAKQRM RWTPELHEAF VEAVNQLGGG  300
ERATPKGVLK LMKVEGLTIY HVKSHLQKYR TARYRPDPSE ATSQRNVTPI EDFSSLDLKT  360
GIEITEALRL QMEVQKRLHE QLEIQRNLQL RIEEQGRYLQ MMFEKQCKSV PDSDKLKTSS  420
STIENQSTLS APESSEKGKT EETAELGSSK PANGSVESVA PESEAGGKTA GKKRSLLETE  480
EGSENLEHND ANDSQPKRSK NNDEGST*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002526559.11e-158PREDICTED: protein PHR1-LIKE 1 isoform X1
TrEMBLB9SKP01e-158B9SKP0_RICCO; Transcription factor, putative
STRINGVIT_07s0005g04120.t011e-155(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G28610.12e-95phosphate starvation response 1